SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.013G111900.3|PACid:26789389 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.013G111900.3|PACid:26789389
Domain Number 1 Region: 142-622
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.83e-94
Family Acetyl-CoA synthetase-like 0.000015
Further Details:      
 
Domain Number 2 Region: 829-1052
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.14e-24
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 
Domain Number 3 Region: 639-697
Classification Level Classification E-value
Superfamily ACP-like 0.00000535
Family Peptidyl carrier domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.013G111900.3|PACid:26789389
Sequence length 1072
Sequence
MAFPSGEQETLQRKHCCLIHEFYRAASKSPDKIAIIHASPSNPSANEVRIDRELINGGNP
PVYKGDRCFTFANLLASVECLSFRICSVLDGADDRYLIKPQTSGDNSNGKHPQSVQMSEA
SLDFIRGVCQHTDLENMYVPKIVALFMPPSVEYVVSVLSVLKCGEAFLPVDPAWPRDRIL
SVLDSLDAALVVTCGSSLVKSGSELVDQLDWLLECCSCPIMRFSMEASIEPHKSQSSLAW
PCENERKRLFCYLIYTSGSTGKPKGVCGTEEGLLNRFLWMQELYPMQGEELLLFKTSISF
IDHLQEFLIAALTACTLVIPPFTELKQNVFSIIDFLQAYSINRLTAVPSLMRMILPAMQS
QHDIRISSSLKLLVLSGEVLPLSLWNVLSNLLPKTSILNLYGSTEVSGDCLYFDCKGLPS
ILEMEKLTSVPIGLPISKCSTVLIGETGNSNVGEICVRGVCVSTGYLFENAIIPLNNAKL
HQNSICKCSMVECGGQIYFRTGDFAHLLSSGDLVFLGRKDRTIKVNGQRIALEELEDTLR
GLNDVVDASVISQKDQGDNEFIVAFISLKEKVKSAEIVKTSIRNSMINKFPSVMVPSRYV
FLESLPMSASGKVDYAQLTDSIFSTSHVKDEIGDIGASNLMQIIKKAICDALMVEDVSDD
DDFFMIGGNSITAAHVSHNLGIDMRLLYTFSTPAKLVISLLEKNVLNNTKFGVNDIPEST
IEPDKVNRFSFPESETPDPLGSKLQGHLSLMPHERNDDQADQSKRLKVDLNKYYVLEPID
LFCGYPWNSAPMRDSFSFSRCNKVMHEGGQVVNGTWQAQLVEVSRTRTGYMQELWKVNME
ACVDASPLVVFNDSDIYLFVGSHSYKFLCINAKSGFIQWETKLQGRVEGSAAIVADFSQV
VVGCYDGNIYFLELLNGNICWTFHTSGEVKCQPIVHAHRGLIWCGSHDHNLYALDYRNKC
CVYTLPCGGSIFGSPAIDETHGALYAASTSGRVTAISIKEMPFCTLWLHELEVPVFGSLS
VSSPHGYVICCLVDGHVVALDSSGCIVWKYSGKLVVQYLLELAYLLRFLLKC
Download sequence
Identical sequences A0A0D2TZ79
Gorai.013G111900.3|PACid:26789389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]