SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.013G133700.5|PACid:26787785 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.013G133700.5|PACid:26787785
Domain Number 1 Region: 7-144
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.36e-30
Family Cap-Gly domain 0.00093
Further Details:      
 
Domain Number 2 Region: 129-380
Classification Level Classification E-value
Superfamily L domain-like 1.22e-21
Family Internalin LRR domain 0.012
Further Details:      
 
Domain Number 3 Region: 443-531
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000556
Family Ubiquitin-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.013G133700.5|PACid:26787785
Sequence length 534
Sequence
MEQTTFFTLGQRVHSSTDPRRVGTVKFVGNVEGYSGIWVGVDWDNEGDGKHDGSINGVRY
FQGRSQNSASFLRPQNLSPGISLLQALKLRYQSHSTEQDEDEMYVLSASNKRVSVQLLGK
DKIQDKLSRFEELTSASISYLGVSTPGDPAEISASVPNLKELDLMGNLITDWKDVGTICE
QLPHLVALNLSNNLMTQNMTGLPLLKAIRVLVLNSTGINWSQVEILEHSLPVIEELHLMG
NNISSIKPTSSSTVQGFDFLRLLNLEDNCLAEWDEILKLSQLKSLEQLYLNTNKLTCIFY
PDKIQEVLSNHESCEESYFPFQNLRCLLLGSNEINDLASIDSLNTFPKLIDIRLSDNPIA
DPARGGLPRFVLIARLAKVEMLNGSEISARERKESEIRYVRLVMSKLLDNPEEINRLHPR
FVELKNFYGIEDERPLVGAAGPQKMASGLLSITLKCVASSVGEKLPLTKKLPATTTVGKL
KALCENFFKLKSLKLKLFLQEEGSPLPMLLDDEMATLMDMGIGNESTIIVDEES
Download sequence
Identical sequences A0A0D2VEU7
XP_012463985.1.20347 XP_012463986.1.20347 XP_012463987.1.20347 XP_012463988.1.20347 Gorai.013G133700.1|PACid:26787784 Gorai.013G133700.2|PACid:26787781 Gorai.013G133700.3|PACid:26787786 Gorai.013G133700.4|PACid:26787783 Gorai.013G133700.5|PACid:26787785 Gorai.013G133700.6|PACid:26787782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]