SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.013G163500.3|PACid:26787025 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.013G163500.3|PACid:26787025
Domain Number 1 Region: 151-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.35e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 2 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.8e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 3 Region: 228-304
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.8e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 4 Region: 304-380
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.22e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 5 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.9e-33
Family Ubiquitin-related 0.000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.013G163500.3|PACid:26787025
Sequence length 381
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
ADYNIQKESTLHLVLRLRGGF
Download sequence
Identical sequences A0A0D2W6P1
Gorai.013G163500.3|PACid:26787025 Gorai.013G163500.4|PACid:26787026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]