SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.N024300.1|PACid:26819291 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.N024300.1|PACid:26819291
Domain Number 1 Region: 59-134
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.48e-28
Family Ubiquitin-related 0.0000302
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.73e-20
Family Ubiquitin-related 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.N024300.1|PACid:26819291
Sequence length 135
Sequence
MVTVLTMNYIFQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGTMI
KVKTLTGKEIEIDIEPTDTIDRIKERVEEKEGIPPVQQRLIYAGKQLADDKTARDYNIEG
GSVLHLVLALRGGRL
Download sequence
Identical sequences A0A0D2SMG6
Gorai.N024300.1|PACid:26819291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]