SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.N024400.2|PACid:26819290 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.N024400.2|PACid:26819290
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.22e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 2 Region: 79-118
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000152
Family Ubiquitin-related 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.N024400.2|PACid:26819290
Sequence length 118
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGTMIKVKTLTGKEIEIDIEPTDTIDRIKERVEEKEGIPPVQQR
Download sequence
Identical sequences A0A0D2VKC3
XP_020203378.1.88050 Gorai.N024400.2|PACid:26819290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]