SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91786475|ref|YP_547427.1| from Polaromonas sp. JS666

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91786475|ref|YP_547427.1|
Domain Number 1 Region: 16-164,213-383
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 1.22e-77
Family Acetamidase/Formamidase-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|91786475|ref|YP_547427.1|
Sequence length 410
Comment formamidase [Polaromonas sp. JS666]
Sequence
MTDTLIKVDLTKSPTENENIHNRWHPDIPMACWVNPGDDFILETFDWTGGFIKNNNSADD
VRDIDLTTVHYLSGPVGVKGAEPGDLLVVDLLDIGAKQDSLWGFNGFFSRNNGGGFLVDH
FPQAQKSIWDFKGMFTSSRHVPGVNFAGLIHPGLIGCLPDRPMLDMWNKREMDFIATDPD
RVPALAVPPSAGTAHMGNMTGAARDKAAAEGARTVPPREHGGNCDIKDLSRGSKVFFPVY
VDGAGLSVGDLHFSQGDGEITFCGAIEMAGWVHMKVSLIKGGMARYGIKNPIFKPSPITP
HYNDYLIFEGISVDEKGKQHYLDVHVAYRQACLNAIEYLKKFGYSGAQAYSILGTAPVQG
HISGVVDIPNACATLWLPTQIFDFDINPNASGPVKHIDGSIDMPLSPDLV
Download sequence
Identical sequences Q12G13
296591.Bpro_0569 gi|91786475|ref|YP_547427.1| WP_011481532.1.11221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]