SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91788998|ref|YP_549950.1| from Polaromonas sp. JS666

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91788998|ref|YP_549950.1|
Domain Number 1 Region: 11-122
Classification Level Classification E-value
Superfamily DOPA-like 4.18e-41
Family DOPA dioxygenase-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|91788998|ref|YP_549950.1|
Sequence length 124
Comment hypothetical protein Bpro_3138 [Polaromonas sp. JS666]
Sequence
MHSLSAIHPMTKRPENVHDRYHAHVYFGPATVAQARALCEQAGELFGVAVGRVHEREIGP
HPHWSCQLAFDRVQFERLIPWLAQNRNGLDVFVHGVTGDNLADHTTHASWLGEASELKLD
MFRR
Download sequence
Identical sequences Q128J0
gi|91788998|ref|YP_549950.1| 296591.Bpro_3138 2005190093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]