SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78186284|ref|YP_374327.1| from Chlorobium luteolum DSM 273

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78186284|ref|YP_374327.1|
Domain Number 1 Region: 1-276
Classification Level Classification E-value
Superfamily Folate-binding domain 1.02e-101
Family Aminomethyltransferase folate-binding domain 0.000000652
Further Details:      
 
Domain Number 2 Region: 276-362
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.42e-19
Family Aminomethyltransferase beta-barrel domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78186284|ref|YP_374327.1|
Sequence length 365
Comment glycine cleavage system aminomethyltransferase T [Chlorobium luteolum DSM 273]
Sequence
MKKTALYPWHEKAGARIIDFGGWLMPVQYSGIIAEHRAVRSAAGLFDVSHMGNFYVKGPR
AEEFLQHMTTNDLSRAKNGQAQYNVMLYPNGGIVDDLIIYRIDAQTFFIIVNAGNCEKDY
QWLQEHAAEYDGVVLEDHSSAMSLIALQGPKAFDILKKVLPSLDAPSLGSFHFCTLEYSG
AELMVARTGYTGEIGVEICMPNEMALPLWEDLLEAGRPEGILPIGLGARDTLRLEMGYSL
YGHEIDQDTNPLEARLKWVVKLDKGHFIGREACLQVELNPKRSVAGFVLEGRALPRQGCK
LFNSDHQEIGRVCSGTLSPTLQEPVGTCSLLREYQKPGTRVFVEIRGTMQPGTIRPLPFV
KTSLS
Download sequence
Identical sequences Q3B5U7
gi|78186284|ref|YP_374327.1| 319225.Plut_0396 WP_011357159.1.73161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]