SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404492849|ref|YP_006716955.1| from Pelobacter carbinolicus DSM 2380

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404492849|ref|YP_006716955.1|
Domain Number 1 Region: 1-183
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.18e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0082
Further Details:      
 
Domain Number 2 Region: 227-295
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.99e-20
Family Ferredoxin domains from multidomain proteins 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|404492849|ref|YP_006716955.1|
Sequence length 310
Comment 2-oxoacid:ferredoxin oxidoreductase, gamma and ferredoxin subunit [Pelobacter carbinolicus DSM 2380]
Sequence
MYRIRFHGRGGQGIKTASRILGTALFIEGFEVQDAPRYGAERRGAPIFAYVRADTIPIQE
RGVIHRPDLVVVADETLLAITPAQVLEGITAATVVLIYSGHPESWWREQFPHVGRIIVLS
PIAEHPGGIPAGAFCAGAAAALLGEVSEEALTQAVEEELAAHDPELVLSNKQAVMTAYAA
VANYHGQVQSGPPLTVNETQPPAWIDMSRDAVDIAAPVIHAGTTSCLVKTGLWRTRRPVI
DKEKCRRCLQCCAWCPEGGIRVGEDGFPVIDYEHCKGCLVCAAQCPFKAIKVIPESQAKE
EQDAQAADRK
Download sequence
Identical sequences Q3A570
gi|404492849|ref|YP_006716955.1| WP_011340961.1.20986 338963.Pcar_1238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]