SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78779424|ref|YP_397536.1| from Prochlorococcus marinus str. MIT 9312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78779424|ref|YP_397536.1|
Domain Number 1 Region: 20-137
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.09e-27
Family FUR-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78779424|ref|YP_397536.1|
Sequence length 144
Comment ferric uptake regulator family protein [Prochlorococcus marinus str. MIT 9312]
Sequence
MIKNTGQKKISETMVTNSDITKRQEQLLEELNKCEDELTGQKLHRQLIERGKVMGLTTVY
RNLQVLIKHGLIRSRHLPTGEVLYTPVDRDIHHLTCVQCGETSKMEGCPVKDIHTPKTNP
KKFQLLFHTLEYFGLCQNCYQAQN
Download sequence
Identical sequences Q31AJ5
WP_011376591.1.55884 WP_011376591.1.72917 74546.PMT9312_1041 gi|78779424|ref|YP_397536.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]