SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78779022|ref|YP_397134.1| from Prochlorococcus marinus str. MIT 9312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78779022|ref|YP_397134.1|
Domain Number 1 Region: 18-148
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.32e-35
Family FUR-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78779022|ref|YP_397134.1|
Sequence length 150
Comment ferric uptake regulator family protein [Prochlorococcus marinus str. MIT 9312]
Sequence
MSLSSQYNVITSPLGDGLHKEGKRLTPQRLKVLNLFENIGSGKHLSAEEVHEKLVKTSSK
VSLATIYRTLRLLVQMGLLHELELSEGGHRYELLSNDTPDHHHLICIRCGRTEEFENDEV
LEAGKDAAKVNGFKLIESSLNVRAICPNCI
Download sequence
Identical sequences Q31BP7
WP_011376193.1.55884 WP_011376193.1.72917 gi|78779022|ref|YP_397134.1| 74546.PMT9312_0637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]