SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|561112722|ref|YP_008855783.1| from Dehalococcoides mccartyi GY50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|561112722|ref|YP_008855783.1|
Domain Number 1 Region: 24-253
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.86e-55
Family Extended AAA-ATPase domain 0.000000348
Further Details:      
 
Domain Number 2 Region: 260-334
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.2e-25
Family Helicase DNA-binding domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|561112722|ref|YP_008855783.1|
Sequence length 349
Comment Holliday junction DNA helicase [Dehalococcoides mccartyi GY50]
Sequence
MSEEKERLISGKLAADDAKLDTSLRPRCLSDFIGQKRLKDNLGVAIQAAKQRGEALDHVL
LYGPPGLGKTTLSHIIALEMGVNIRITSGPAIERQGDLAAILTNLKPFDILFIDEIHRLS
RNVEEVLYPAMEDYALDIMVGKGPGARSLRLKLPHFTLIGATTRYAMLSAPLRDRFGSIF
RLDFYDEEAIYDIVRRSARILGVEADENGLHQIACRSRGTPRVANRLLRRVRDYAQVKGN
GLITGDIAAESLACLEVDKLGLDEIDHKVLKTIIHKFGGGPVGLETIAAAISEEADTIMD
VYEPYLLQLGFLERTPRGRQATRLAYQHLSIPYPADKNTQQGLWAENGT
Download sequence
Identical sequences A0A076I6C1
gi|561112722|ref|YP_008855783.1| WP_023652112.1.46065 WP_023652112.1.65481 WP_023652112.1.96037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]