SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384194677|ref|YP_005580422.1| from Bifidobacterium animalis subsp. lactis V9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384194677|ref|YP_005580422.1|
Domain Number 1 Region: 209-342
Classification Level Classification E-value
Superfamily CBS-domain pair 2.53e-28
Family CBS-domain pair 0.0027
Further Details:      
 
Domain Number 2 Region: 355-435
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.09e-17
Family CorC/HlyC domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384194677|ref|YP_005580422.1|
Sequence length 451
Comment hemolysin-like protein [Bifidobacterium animalis subsp. lactis V9]
Sequence
MSLGLNILLIFVFLLLGSVFAGTELALVSLRGSQIDQMEQEDARGKRVAKIARDPNTFLS
TVQIGVTLSGFLSASFGESSISPFIVPVVEGWGVPSNVAAPLTTIVLTLVISYCSIVISE
MVPKRIAMQRNEQIARAVVPAISAFAKVCRPIIWLIGKNTNGIVRLLGFDPNETESEVSD
EELRVLVSSNTNLTKDERTILDDVFDASETIVAEVMRPRADVVFLDGDTPLADAAAQVRE
LPYSRYPVIGKSFDDVLGFVHVRDLLDVRDPNAKTVADVTREGISLPGTSKLLPSLSLLR
KRGIHLAVVIDEYGGTDGIVTLEDMTEELVGDIRDEYDLPEDTPKDKLPTDVFVDGVATI
DGGMTIEDFADLTGIELEDGPYETVAGYFLAHSGKMGEVGDHLVVDDAYTMTITKVDGRR
IETIEVRKGTANGGTEVSDDQQANDPEHSDK
Download sequence
Identical sequences B8DV50 D3R7I8
gi|518656517|ref|YP_008142879.1| gi|219682544|ref|YP_002468927.1| WP_004219322.1.14456 WP_004219322.1.20477 WP_004219322.1.22654 WP_004219322.1.23267 WP_004219322.1.23846 WP_004219322.1.23969 WP_004219322.1.26294 WP_004219322.1.34099 WP_004219322.1.38287 WP_004219322.1.38998 WP_004219322.1.45260 WP_004219322.1.45775 WP_004219322.1.47471 WP_004219322.1.47549 WP_004219322.1.50484 WP_004219322.1.53490 WP_004219322.1.62237 WP_004219322.1.66072 WP_004219322.1.75174 WP_004219322.1.78909 WP_004219322.1.86686 WP_004219322.1.86797 WP_004219322.1.94304 gi|384193121|ref|YP_005578867.1| gi|384194677|ref|YP_005580422.1| gi|241190121|ref|YP_002967515.1| gi|384191469|ref|YP_005577216.1| gi|241195527|ref|YP_002969082.1| 442563.BLA_0048 555970.Balat_0057 580050.Balac_0057 gi|387819983|ref|YP_006300026.1| gi|384190332|ref|YP_005576080.1| gi|387821637|ref|YP_006301586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]