SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384194902|ref|YP_005580647.1| from Bifidobacterium animalis subsp. lactis V9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384194902|ref|YP_005580647.1|
Domain Number 1 Region: 1-233
Classification Level Classification E-value
Superfamily ITPase-like 6.02e-58
Family ITPase (Ham1) 0.00000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384194902|ref|YP_005580647.1|
Sequence length 239
Comment Xanthosine triphosphate pyrophosphatase [Bifidobacterium animalis subsp. lactis V9]
Sequence
MNIVVATHNEGKLVEIRDILAEEFGDGAHDIELVSAGSLGLPDPVETGITFEANALLKAR
FVARLTGLPAIADDSGLIVDVMGNAPGILSARWAGEHGNDAANIDLLLAQIEDIPDDDRT
ARFRCAAALVVPIAAEEDVADFEADPSDGMDDGDGLVDARETVVLGEMPGTIVRHPHGSN
GFGYDPIFMPDEQPAGAEESGELLTSAEMTPEQKNAISHRGKALRALMPAIRELVETGE
Download sequence
Identical sequences B8DVS6 D3R3J1
gi|387820209|ref|YP_006300252.1| gi|384191718|ref|YP_005577465.1| 442563.BLA_0275 555970.Balat_0287 580050.Balac_0287 gi|384193346|ref|YP_005579092.1| gi|219682770|ref|YP_002469153.1| gi|384194902|ref|YP_005580647.1| gi|518656738|ref|YP_008143100.1| WP_004268398.1.14456 WP_004268398.1.16162 WP_004268398.1.20477 WP_004268398.1.21588 WP_004268398.1.22654 WP_004268398.1.23267 WP_004268398.1.23846 WP_004268398.1.26294 WP_004268398.1.34099 WP_004268398.1.38287 WP_004268398.1.38998 WP_004268398.1.45260 WP_004268398.1.45775 WP_004268398.1.47471 WP_004268398.1.47549 WP_004268398.1.50484 WP_004268398.1.53490 WP_004268398.1.62237 WP_004268398.1.66072 WP_004268398.1.75174 WP_004268398.1.78909 WP_004268398.1.86686 WP_004268398.1.86797 WP_004268398.1.94304 gi|387821871|ref|YP_006301820.1| gi|384190577|ref|YP_005576325.1| gi|241195752|ref|YP_002969307.1| gi|549471790|ref|YP_008605497.1| gi|241190346|ref|YP_002967740.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]