SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400005522 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400005522
Domain Number 1 Region: 290-641
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.06e-39
Family UDP-glucose pyrophosphorylase 0.0013
Further Details:      
 
Domain Number 2 Region: 77-169
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000942
Family RimM N-terminal domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 176-260
Classification Level Classification E-value
Superfamily PRC-barrel domain 0.0000000000439
Family RimM C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400005522
Sequence length 645
Comment PGSC0003DMT400007946
Sequence
MQGSSALSCSSNSISAPVGLCCSQRLTLPFRNQRIGFLENPSSLKIFHFHRNTTFPLLNC
TATEEIVEASETEGLFVETGYIYSVHGLQGEVRVKATTDFPELRFSQPGRRWLRQQVTGR
DMIQEIELVEGRGHPGQKSWILKFHEISTIEQAQKLVGSALLVKDEDRPILEEGEFYTPD
LVGMKVFLKETRELVGTVINVFNSGASDLLHVELLPDRNARPQLEGSASGPLVWVPFVEA
IVPNIDLSKREMLITPPKGLLELNIRADERSKKERRQLEWKERKKSQKRLIAAKKILHEM
EQDHIFHGFRYGEKNQRSFLANQIVDVNSILLQHALQNKKIPYKRWSFPDFVNALQVNNT
LKLSKEFFSKENVEHSSIGSKVQEQGHCLISSGKVAIVLALTESKPAGPHEEIAYLHVKA
LLNDSHRLLKMEDRPSVPLIVVCPAESIEYLKQLFMDHDYFSFDSEKVWFLEEEKLPVVS
ASQEEENKHKILMKSPWEILQRPAGSAGIVTLLSSQNLLEHLHVMGVEYIQVCSGNQEFI
NGEMLLGFTKSREANAGIQVFRDAGYLEEHFNIVFSIDFAKKLTKKIDKLQFEAILKPNQ
YVEMVEKEWVDVIPSSPNSYEFHSSIYSCLNACPPSKVCLVDIIA
Download sequence
Identical sequences M0ZTT0
PGSC0003DMP400005522 XP_006355633.1.80749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]