SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400006264 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400006264
Domain Number 1 Region: 30-209
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.44e-66
Family Inorganic pyrophosphatase 0.0000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400006264
Sequence length 214
Comment PGSC0003DMT400009045
Sequence
MAENSGKGIGRNSGTSRVALNERILSSMSRRSIAAHPWHDLEIGPGAPSIFNCVVEIGKG
SKVKYELDKASGLIKVDRILYSSVVYPHNYGFIPRTLCEDSDPMDVLVLMQEPVLPSTFL
RARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYTDIKELPPHRLAEIRRFFEDYKKNENK
SVAVEDFLPAEAAVEAIKYSMDLYASYIVESLRK
Download sequence
Identical sequences M0ZVI2
PGSC0003DMP400006264 XP_006340642.1.80749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]