SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400006827 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400006827
Domain Number 1 Region: 62-281
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3e-59
Family G proteins 0.000000155
Further Details:      
 
Domain Number 2 Region: 359-449
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 6e-36
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000135
Further Details:      
 
Domain Number 3 Region: 260-355
Classification Level Classification E-value
Superfamily Translation proteins 1.3e-30
Family Elongation factors 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400006827
Sequence length 450
Comment PGSC0003DMT400009804
Sequence
MASVVFRNPNSKRVLSLSPQIYSCCRGGSVSSQFSLSQTRNGNDTSSLSNPWWRSMATFN
RTKPHVNVGTIGHVDHGKTTLTAAITKVLAEEGKAKAVAFDEIDKAPEEKKRGITIATAH
VEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAPDGPMPQTKEHILLARQVG
VPSLVCFLNKVDAVDDLELLELVEMELRELLSFYKFPGDEIPIIRGSALSALQGTNEEIG
KKAILKLMDAVDEYIPDPVRQLDKPFLMPVEDVFSIQGRGTVATGRIEQGTIKVGEDVEI
LGLMQGTLKSTVTGVEMFKKILDNGQAGDNVGLLLRGLKREDITRGMVIAKPGSVKTSKK
FEAEIYVLTKDEGGRHTAFFSNYRPQFYMRTADITGKVELPENVKMVMPGDNVTATFELI
SPVPLETGQRFALREGGRTVGAGVVSKVLS
Download sequence
Identical sequences M0ZWY7
XP_006358430.1.80749 PGSC0003DMP400006827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]