SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400007449 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400007449
Domain Number 1 Region: 31-100
Classification Level Classification E-value
Superfamily TSP9-like 4.18e-18
Family TSP9-like 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400007449
Sequence length 100
Comment PGSC0003DMT400010663
Sequence
MASLNLFVPPIATTTQRRVVYTRATSTKSFGVSSEEKSILDFVLGALQKEDQLLETDPIM
KKVEGKSGTTTSFNKKSVSISPPQKDYNGFGGFGSLFAKK
Download sequence
Identical sequences M0ZYE5
PGSC0003DMP400007449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]