SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400007506 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400007506
Domain Number 1 Region: 12-325
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 8.24e-133
Family Bacterial photosystem II reaction centre, L and M subunits 0.0000000000338
Further Details:      
 
Domain Number 2 Region: 517-647
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 5.62e-35
Family Initiation factor IF2/eIF5b, domain 3 0.00016
Further Details:      
 
Domain Number 3 Region: 651-783
Classification Level Classification E-value
Superfamily Translation proteins 1.69e-28
Family Elongation factors 0.0008
Further Details:      
 
Domain Number 4 Region: 416-511
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000109
Family Elongation factors 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400007506
Sequence length 784
Comment PGSC0003DMT400010772
Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI
DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL
LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGNSGTFNFMI
VFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEE
TYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQ
SVVDSQGRVINTWADIINRANLGFITTPLTTGRLPSQRLDPALPKLFWFTPTFPTCPTVA
EQFLDIKRTSPEGNFNVADFPSFAISFATAPAALANCPPFPSVISMLCMAVPKGISVECT
VLEVKAIEGHGTTIDVVLINGPYCHLNPCIIDASPNEGTLNKGTKLCVLDAFSFDYLGSY
LHHKEIKAAQGININAQGLEYAIAGTSLYVVGPDDDVEHIKEAAMEDMRSVMSRIDRSGE
GVYVQASTFGSLEALLEFLKTDEVRIPVSGIGIGPVHKKDVMKASVMLEKKKEYATILAF
DVKVTQEAQELADEAGVKNFIADIIYHLFDQFKAYIDNLKEEKKKEVAEEAVFPCSLKIV
PNHVYNKKDPIVVGVDVLEGIARVGTPICIPQREFIDIGQIASIENNHRPVDSAKKGQRV
SIKIVGSNCEEIQKMFGRHFEMEDDLVSKVSRRSIDILKANFRNELSIEDWRLVKTLKNL
FKIQ
Download sequence
Identical sequences M0ZYJ3
PGSC0003DMP400007506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]