SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400007776 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400007776
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 4.32e-32
Family Initiation factor IF2/eIF5b, domain 3 0.0002
Further Details:      
 
Domain Number 2 Region: 128-161
Classification Level Classification E-value
Superfamily Translation proteins 0.0000918
Family Elongation factors 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400007776
Sequence length 276
Comment PGSC0003DMT400011181
Sequence
MEDMKSVMSRIDKTGEGVYVQATTLGSLEALLEFLKTPGVSIPVSGIGIGPVHKKNVIKA
SVMLEKKKEYSTILAFDVKVTQGARELSDELGVKVFMADIIYHLFDQFKAYIDTIKEEKK
KEVAEEAVLPCVLKIIPNCVFKKKDPIVLGVDVLKGIFRIEELELKKKQQETKAIETSRK
AIPSMEKCKKQLMIANSDFMEKMEAFSSPVKGVKMSKAQQSSGDDRASHVSISRKEYGHQ
QVRKCCSSSAISLPQGAASWLVLAIPRNIASDESII
Download sequence
Identical sequences M0ZZ58
PGSC0003DMP400007776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]