SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400008340 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400008340
Domain Number 1 Region: 30-236
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.29e-39
Family G proteins 0.00000598
Further Details:      
 
Domain Number 2 Region: 240-354
Classification Level Classification E-value
Superfamily Translation proteins 2.7e-36
Family Elongation factors 0.0000439
Further Details:      
 
Domain Number 3 Region: 355-452
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 9.59e-30
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400008340
Sequence length 464
Comment PGSC0003DMT400011988
Sequence
MSRKGLMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRF
KNELERNITIKLGYANAKIYKCEEDRCPRPMCYKAYGSGKEDGPMCDVPGFETCRMKLLR
HVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPQTSEHLAAVEIMRLQHIIIL
QNKVDLVQENVAINQHEAIQKFIQGTVADGAPVVPISAQLKYNIDVVAEYIVKKIPIPER
NFISPPNMIVIRSFDVNKPGFEVDDIRGGVAGGSILKGVLKVNQLIEVRPGITVKDESGN
IKCTPIYSRIVSLFAEQNELQFAVPGGLIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVF
VELEVNFFLLRRLLGVRTKDTERQGKVSKLAKGEILMLNIGSMSTGARVVAVKNVFAKLQ
LTSPVCTSKGEKIALSRRIEKHWRLIGWGQIQAGITLDVPPCPI
Download sequence
Identical sequences M1A0I0
XP_006349820.1.80749 XP_015165240.1.80749 PGSC0003DMP400008340 PGSC0003DMP400008341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]