SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400008398 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400008398
Domain Number 1 Region: 96-371
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.53e-109
Family G proteins 0.00000003
Further Details:      
 
Domain Number 2 Region: 569-689
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.39e-42
Family Translational machinery components 0.0000309
Further Details:      
 
Domain Number 3 Region: 354-494
Classification Level Classification E-value
Superfamily Translation proteins 8.84e-36
Family Elongation factors 0.0000767
Further Details:      
 
Domain Number 4 Region: 693-783
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 6.23e-26
Family EF-G/eEF-2 domains III and V 0.00034
Further Details:      
 
Domain Number 5 Region: 494-571
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.73e-24
Family EF-G/eEF-2 domains III and V 0.0000444
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400008398
Sequence length 787
Comment PGSC0003DMT400012076
Sequence
MAAESVTRMSSAASSLCNFNGSQRPVPVSNRVASSRRNRCVKLQSLASASMSEFFGSSRV
FSVNGSKSLGLSQKTRKNGFSVIAMAAAEEEKRTVPLKDYRNIGIMAHIDAGKTTTTERV
LYYTGRNYKIGEVHEGTATMDWMEQEQERGITITSAATTTFWNKHRINIIDTPGHVDFTL
EVERALRVLDGAICLFDSVAGVEPQSETVWRQADKYGVPRICFVNKMDRLGANFFRTRDM
IVTNLGAKPLVIQIPIGAEDTFKGLVDLVMMKAIVWSGEELGAKFSYEDIPADLQELAEE
YRALMIETVVELDDDVMEKYLEGVEPDDATIKQLIRKGTISGNFVPVLCGSAFKNKGVQP
LLDAVVDYLPSPVDVPPMNGTDPDNPEVIIERAPSDDEPFTGLAFKIMNDPFVGSLTFVR
VYSGKLTAGSYVLNANKGRKERIGRLLEMHANSREDVKTALTGDIVALAGLKDTITGETL
SDPEKPVVLERMDFPDPVIKVAIEPKTKADIDKMAQGLIKLAQEDPSFHFSRDEEVNQTV
IEGMGELHLEIIVDRLKREFKVEANVGAPQVNYRESISRNAEVKYVHKKQSGGSGQFADI
TVRFEPMEAGGGYEFKSEIKGGAVPKEYIPGVMKGLEECMSNGVLAGFPVVDVRAVLVDG
SYHDVDSSVLAFQLAARGAFREGMRKASPQLLEPIMKVEVVTPEEHLGDVIGDLNSRRGQ
INSFGDKPGGLKVVDALVPLAEMFNYVSTLRGMTKGRASYVMQLAKFDVVPQHIQNQLAK
KEEAAAA
Download sequence
Identical sequences M1A0N5
PGSC0003DMP400008398 XP_006355498.1.80749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]