SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400009676 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400009676
Domain Number 1 Region: 740-1028
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.51e-60
Family G proteins 0.00000495
Further Details:      
 
Domain Number 2 Region: 1062-1165
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 9.42e-26
Family Initiation factor IF2/eIF5b, domain 3 0.00049
Further Details:      
 
Domain Number 3 Region: 1162-1243
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000636
Family Elongation factors 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400009676
Sequence length 1294
Comment PGSC0003DMT400013995
Sequence
MGRKKATEENSEPPKQGGGGGKSKKKNRVIDDDEYSIQTEEPTVQEETALPPAGKKAANK
SGDKDDEKEEDDDERKKPAKQGGGDGWKSRKKYVVINDDEYTVGTEDPVVLEEKVIPGGK
KKAKKGKKGASNYGEDLTRDSDQEDEGIAPFSGKLNKSKQGKASASVFSTVFDTIGDEES
EEDEEPVIAGMGKTIGNSFSVALLDEEEEADTSSKFDTETAEEDDAPELIFAGKKKSSKK
KKKSAVTEANVREEAESEQACPGVNPEEEANDTDRKKQQRDVPETCKNKTKKKKGGSTVQ
EDEDEIDKILAELGEEAAPAPSEEKVQVQLESKDNKSKKKKGGRTAQEEDDIDKILAEIG
EGPPATSAPTLASLPQEEKGQLQPQLGDAAVEKEAVEEGAMESAAAKKKKKKKEKEKEKK
AAAAASNVEEKQEETKNDAKGKLVDKKQSKQVREMQERLKKMKETEERKKREEEEKLRKE
EEERRLQEELEKLAEEKKRLKKEREKEKLLKKKQEGKLLTGKQKEEARRLEAMRKQFLAN
GGTLPTGENKKETTKRPIYQTKKSKPQSQANDKTQEESIEISEVKEHHQEIVSEVDSVET
EKVEDVDSRITEEKSEIADAEENEVEEEEEDDEEWDAKSWDDADLKLPGKSAFEDEEVDS
EQQPITKKEIKVASSAVHGAPTLPVAVKSVIPTQKTAATVPGVLKNDRSRKGEPEDRDAE
QNKQKGSPEEPGAPNQNEDNLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQI
GATYFPAENIRERTKELKADAKLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIM
HGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWKVCKNAPIVKAMKQQSKDVQFEFNTR
LTQIVTQFKEQGINTELYYKNKEMGKDTFSIVPTSAISGEGIPDMLLLLVQWTQKTMIER
LTYSNEVQCTVLEVKVIEGHGTTIDVVLVNGVLHEGDQIVGPIVTSIRALLTPHPMKELR
VKGTYLHHKKIKAAQGIKITAQGFEHAIAGTSLYVVGPDDDVEDIKEAAMEDMKSVMSRI
DKSGEGVYVQASTLGSLEALLEFLKTPEVSIPVSGIGIGPVHKKDVMKASVMLEKKKEYA
TILAFDVKVTQEARELSDELGVKIGSPICIPQKDFIDIGRIASIENNHKPVDSAKKGQRV
AIKIVGSNPEEQQKMFGRHFEMEDELVSKISRRSIDILKANFRVFVAFKGVGSWFSDKHH
RRGLAAHRAISGDLTVNKSLDPMFMHLRDRNEQK
Download sequence
Identical sequences M1A3M1
PGSC0003DMP400009676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]