SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400009965 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400009965
Domain Number 1 Region: 36-127,161-300
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.88e-42
Family G proteins 0.000000583
Further Details:      
 
Domain Number 2 Region: 378-483
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.06e-26
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00031
Further Details:      
 
Domain Number 3 Region: 281-374
Classification Level Classification E-value
Superfamily Translation proteins 2.7e-20
Family Elongation factors 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400009965
Sequence length 491
Comment PGSC0003DMT400014425
Sequence
MWHPPHQNISDIRLGVHLGSPNRGGVYLSHLANVGDAGKSTAGGQILFLSGQVDDRTIQK
YEKEAKDKSRESWYMAYIMDTNEEERAKGKTVEVGRAHFETETTRFTILDAPGHKSYIPN
MISGASQADIGVLVRMVTFCHWTPWEFMNSISGFRKCTLIFDLVILKVISARKGEFETGY
ERGGQTREHVQLAKTLGVSKLLVVVNKMDDPTVVWSKERYDDIQSKMMPFLKSSQYNVKK
DVQFLPISGLLGSNMKTRVEERVCAWWDGPCLIEALDAVEVPPRDPEGPLRMPIIDKFKD
LGNVVMGKTESGSICEGDSLLMMPNKAVVKVPALFCDEDRVRYADPGENVRVRLSGIEEE
DILSGFVLCSVAKPIPAVTEFVAQLQILELLDNAIFTAGYKAVLHIHAIVEECEIVELMQ
QIDLKKKKPMKKTPLFVKNGAIVLCRVQVNNLICIEKFSDFPQLGRFTLRSEGKTVAVGK
VTTLPTVANNA
Download sequence
Identical sequences M1A476
PGSC0003DMP400009965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]