SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400009970 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400009970
Domain Number 1 Region: 224-329
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.05e-26
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00031
Further Details:      
 
Domain Number 2 Region: 1-139
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.1e-22
Family G proteins 0.0000514
Further Details:      
 
Domain Number 3 Region: 127-220
Classification Level Classification E-value
Superfamily Translation proteins 1.41e-20
Family Elongation factors 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400009970
Sequence length 337
Comment PGSC0003DMT400014430
Sequence
MISGASQADIGVLVISARKGEFETGYERGGQTREHVQLAKTLGVSKLLVVVNKMDDPTVV
WSKERYDDIQSKMMPFLKSSQYNVKKDVQFLPISGLLGSNMKTRVEERVCAWWDGPCLIE
ALDAVEVPPRDPEGPLRMPIIDKFKDLGNVVMGKTESGSICEGDSLLMMPNKAVVKVPAL
FCDEDRVRYADPGENVRVRLSGIEEEDILSGFVLCSVAKPIPAVTEFVAQLQILELLDNA
IFTAGYKAVLHIHAIVEECEIVELMQQIDLKKKKPMKKTPLFVKNGAIVLCRVQVNNLIC
IEKFSDFPQLGRFTLRSEGKTVAVGKVTTLPTVANNA
Download sequence
Identical sequences M1A478
PGSC0003DMP400009970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]