SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400010161 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400010161
Domain Number 1 Region: 57-161
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 8.02e-23
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00086
Further Details:      
 
Domain Number 2 Region: 5-74
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000732
Family Elongation factors 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400010161
Sequence length 165
Comment PGSC0003DMT400014674
Sequence
MPFRDVATVRSLERDSQVYNAAKAGDSVTINLQGIDANHVMAGGVLCHPEFPVPVANHLE
LKVLILDNGIPILIGSQLEFLVHHAKEAARVVRILSLLDPKTGKETKKSPRCLLAKQNAM
IEVVLQGMVCIDEHSNCKALGRVSLRSSGRTVALGLVTRVIGKQE
Download sequence
Identical sequences M1A4P6
PGSC0003DMP400010161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]