SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400014282 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400014282
Domain Number 1 Region: 3-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.4e-79
Family G proteins 0.0000000312
Further Details:      
 
Domain Number 2 Region: 326-430
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.81e-42
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000512
Further Details:      
 
Domain Number 3 Region: 226-321
Classification Level Classification E-value
Superfamily Translation proteins 5.96e-28
Family Elongation factors 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400014282
Sequence length 447
Comment PGSC0003DMT400020968
Sequence
MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK
VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPTDKPLRLPLQD
VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNV
KNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQT
VAVGVVKNVDKKDPTGAKVTKAAQKKK
Download sequence
Identical sequences M1AED5
PGSC0003DMP400014282 PGSC0003DMP400014283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]