SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400014688 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400014688
Domain Number 1 Region: 47-121
Classification Level Classification E-value
Superfamily Translation proteins 3.39e-17
Family Gar1-like SnoRNP 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400014688
Sequence length 191
Comment PGSC0003DMT400021579
Sequence
MRPPRGRGGGGFRGGRDGGGRGFRGGGGGRGGGRFPPRDEGPPSEVVEVASFVHACEGDA
VTKLTNEKIPYFNAPIYLQNKTQIGKVDEIFGPINESLFSIKMMEGIIATSYSAGDKFYI
DPAKLLPLARFLPQPKGSQQAFRGGGRGGGRGGRGGGGGFRGARGGGGGFRGGRGPPRGG
RGGGFRGRGRF
Download sequence
Identical sequences M1AFC7
PGSC0003DMP400014688 XP_006362256.1.80749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]