SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400015459 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400015459
Domain Number 1 Region: 96-210
Classification Level Classification E-value
Superfamily Translation proteins 2.08e-36
Family Elongation factors 0.0000463
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.67e-16
Family G proteins 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400015459
Sequence length 240
Comment PGSC0003DMT400022693
Sequence
MDAAFLLIAANESCPQPQTIEHLSAVDILKLQNLIVLQNKVDTIQEHQARKQYKAIREFL
KGTVAQDAPVVPVSSQLNYNIDAVCEYITKIPIPKRDFVSPPHMVVVRSFDVNKPGCGIN
DMKGGVVGGTITKGVLKVNQIVELRPGIIEKNADGKTICKPIYSRIMSLFSEQNKLQFAV
PGGLIGVGTSMDPALSRSDMLVGQVLGDVGTLPEVYIKLKVSMHSLAFLSVVCNFFYCLY
Download sequence
Identical sequences M1AH29
PGSC0003DMP400015459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]