SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400015461 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400015461
Domain Number 1 Region: 24-228
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.39e-39
Family G proteins 0.00000581
Further Details:      
 
Domain Number 2 Region: 234-348
Classification Level Classification E-value
Superfamily Translation proteins 7.07e-36
Family Elongation factors 0.0000463
Further Details:      
 
Domain Number 3 Region: 349-420
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.000000000192
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400015461
Sequence length 421
Comment PGSC0003DMT400022695
Sequence
MEQQDIRKLDVTKLHPLSPEVISRQPTINIGLIGHVAHGKTTLVRAISGIQTTRFKCELE
RNITVKLGYANAKIYKCEDESCPQPLCYMSYGSGKEDNPPCDVPGFRNCKMKLLRHISFV
DCPGHEILMTRMLSGATVMDAAFLLIAANESCPQPQTIEHLSAVDILKLQNLIVLQNKVD
TIQEHQARKQYKAIREFLKGTVAQDAPVVPVSSQLNYNIDAVCEYITKIPIPKRDFVSPP
HMVVVRSFDVNKPGCGINDMKGGVVGGTITKGVLKVNQIVELRPGIIEKNADGKTICKPI
YSRIMSLFSEQNKLQFAVPGGLIGVGTSMDPALSRSDMLVGQVLGDVGTLPEVYIKLKIR
KIKLLRRLVGVEKNDFGKQVSNLLKGEVLMLNILSMTIGAQIITVRKNSATLQLTAPVCT
P
Download sequence
Identical sequences M1AH31
PGSC0003DMP400015461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]