SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400018226 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PGSC0003DMP400018226
Domain Number - Region: 275-310
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00011
Family Rho termination factor, N-terminal domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400018226
Sequence length 315
Comment PGSC0003DMT400026701
Sequence
MCNASSFSNHKRNPDFSRQNKHGFSRERNRQNEDRDGYDNIEESEMLSSRNGPLLTTSNT
SRFQATATPGPREKEIVELFRKVQAQLREKAAIKEEKKSEELQGKGKESETVDSLLKLLR
KHSVQKGKKTSSSRSSNFVLDQPDKSNVFSEKRASNLTELNSNVNHVAQESGTPFVNRPK
SNFQRRSPVPRIKFQPIYHEGGTDYPAASSAPDKMEEDIHLDAELGQIPRSKVDSDTEPI
FSDKHVFDEMADDDTAKMYESVDASDDEEHNQVGHDELAEMKLTELRAIAKSRGLRGYSK
VKKLELIELLSADQV
Download sequence
Identical sequences M1ANL7
PGSC0003DMP400018226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]