SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400018924 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400018924
Domain Number 1 Region: 100-199
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.84e-25
Family 2Fe-2S ferredoxin-related 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400018924
Sequence length 215
Comment PGSC0003DMT400027786
Sequence
MVGFHNLRLAHRLTGCSLSSLLLHGSASTCELSLKVGCRSYCTGTSNRVRNLFPLNYISA
PLACIPRTSYTHLLRYSSTQGLRHEQFCTAAGNEAEQKISVTFVDKDGEENHIKVPVGMS
MLEAAHENDIELEGACEASLACSTCHLIVMDMEYYNKLEDPTDEENDMLDLAFALTDTSR
LGCQVIAKPELDGIRLALPVATRNFAVDGYKPKPH
Download sequence
Identical sequences M1AQ63
XP_006366548.1.80749 PGSC0003DMP400018924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]