SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400021384 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400021384
Domain Number 1 Region: 12-106
Classification Level Classification E-value
Superfamily Translation proteins 1.01e-34
Family Ribosomal protein L35ae 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400021384
Sequence length 112
Comment PGSC0003DMT400031543
Sequence
MVKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYLGKRLGYIYKA
KTKKNNSHYRCIWGKVCRPHGNSGVVRAKFKSNLPPKSMGAKVRVFMYPSNI
Download sequence
Identical sequences A0A0V0H4A1 A0A1U8G170 M1AVU1
XP_006368064.1.80749 XP_016564870.1.72714 PGSC0003DMP400021384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]