SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400021498 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400021498
Domain Number 1 Region: 202-372
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-45
Family G proteins 0.00011
Further Details:      
 
Domain Number 2 Region: 511-624
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 3.4e-25
Family Initiation factor IF2/eIF5b, domain 3 0.0023
Further Details:      
 
Domain Number 3 Region: 619-720
Classification Level Classification E-value
Superfamily Translation proteins 8.97e-23
Family Elongation factors 0.00019
Further Details:      
 
Domain Number 4 Region: 378-460
Classification Level Classification E-value
Superfamily Translation proteins 1.19e-18
Family Elongation factors 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400021498
Sequence length 736
Comment PGSC0003DMT400031711
Sequence
MAWRAAGKKGTFTSLTKALAVRSRYTAASVSKSNLEEVQRTIPVLVGQIQGCFLHAAQWK
SNCTNLLTYRTSIRCFHASPETLAWKKEPEALGLKIQKKGKFKKRTKDSSPPVEAPYVPP
KLKRAASSSLSDRTVEIFEGMTIVELAKRCGVSIPVVQDILKNVGEKVDSEYDPLSIDIS
ELVAMEIGVNVRRLHSNEGAEVLPRPPVVTVMGHVDHGKTSLLDALRLTSVAAKEAGGIT
QHLGAFVVGMSSGASITFLDTPGHAAFSAMRQRGAAVTDIVVLVVAADDGVMPQTLEAMS
HAKAADVPIVVAVNKCDKPAANPEKVKIQLATEGLALEEMGGDIQVVEVSAVTKTGLDKL
EEALLLQAEMMDLKSRVDGPAQAYVVEARVDRGRGPLATAIVKAGTLVCGQHVVVGAEWG
KIRAIRDMLGKSTDRARPAMPVEIEGLKGLPMAGDDIIVVHSEERARMLSAGRKKKFEKD
RLGRKMDAEKLGSLVSESNLEDEEGEVEEKPKRVEMTIIVKADVQGTVQAVTDSLKSLDS
PQVFVNIVHGGVGPISESDVDLAQACGAFIVGFSIPTPPGSINQAANKAGIKIKIHRVIY
HLLEDIGNSIVEKAPGTFETQVSGEAQILSIFELKGRSKAKGDDVKIAGCRVIDGRLIRS
STMRLLRSGEVVFEGSCASLKREKQDVEAVGKGNECGLVIQNWDDFKVGDVIQCLEQVNR
KPKFISSQSGAVRIEC
Download sequence
Identical sequences M1AW32
XP_006343899.1.80749 PGSC0003DMP400021498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]