SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400021499 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400021499
Domain Number 1 Region: 162-332
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.7e-46
Family G proteins 0.00011
Further Details:      
 
Domain Number 2 Region: 471-584
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 3.01e-25
Family Initiation factor IF2/eIF5b, domain 3 0.0023
Further Details:      
 
Domain Number 3 Region: 579-680
Classification Level Classification E-value
Superfamily Translation proteins 8.16e-23
Family Elongation factors 0.00019
Further Details:      
 
Domain Number 4 Region: 338-420
Classification Level Classification E-value
Superfamily Translation proteins 1.09e-18
Family Elongation factors 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400021499
Sequence length 696
Comment PGSC0003DMT400031712
Sequence
MYHMFSLYTAGCFLHAAQWKSNCTNLLTYRTSIRCFHASPETLAWKKEPEALGLKIQKKG
KFKKRTKDSSPPVEAPYVPPKLKRAASSSLSDRTVEIFEGMTIVELAKRCGVSIPVVQDI
LKNVGEKVDSEYDPLSIDISELVAMEIGVNVRRLHSNEGAEVLPRPPVVTVMGHVDHGKT
SLLDALRLTSVAAKEAGGITQHLGAFVVGMSSGASITFLDTPGHAAFSAMRQRGAAVTDI
VVLVVAADDGVMPQTLEAMSHAKAADVPIVVAVNKCDKPAANPEKVKIQLATEGLALEEM
GGDIQVVEVSAVTKTGLDKLEEALLLQAEMMDLKSRVDGPAQAYVVEARVDRGRGPLATA
IVKAGTLVCGQHVVVGAEWGKIRAIRDMLGKSTDRARPAMPVEIEGLKGLPMAGDDIIVV
HSEERARMLSAGRKKKFEKDRLGRKMDAEKLGSLVSESNLEDEEGEVEEKPKRVEMTIIV
KADVQGTVQAVTDSLKSLDSPQVFVNIVHGGVGPISESDVDLAQACGAFIVGFSIPTPPG
SINQAANKAGIKIKIHRVIYHLLEDIGNSIVEKAPGTFETQVSGEAQILSIFELKGRSKA
KGDDVKIAGCRVIDGRLIRSSTMRLLRSGEVVFEGSCASLKREKQDVEAVGKGNECGLVI
QNWDDFKVGDVIQCLEQVNRKPKFISSQSGAVRIEC
Download sequence
Identical sequences M1AW33
PGSC0003DMP400021499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]