SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400021518 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400021518
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000478
Family Extended AAA-ATPase domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400021518
Sequence length 148
Comment PGSC0003DMT400031736
Sequence
MVGLPSVENREMIMKTLLAKERVDDGMDFKELGTMTEGYSGSDLKNLCTTAAYRPVRELI
QQERLKDLDKKCRAEEAKKAGVAPSTDADKEDKVITIRPLNMADFKEAKKQVAASFAAGG
AIMSELKQWNESYGEGGSRKKEQLSYFL
Download sequence
Identical sequences M1AW52
PGSC0003DMP400021518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]