SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400022501 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PGSC0003DMP400022501
Domain Number - Region: 503-544
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000216
Family Rho termination factor, N-terminal domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400022501
Sequence length 547
Comment PGSC0003DMT400033068
Sequence
MLQSQLSRTDERWLDMCIAALNKKIDRLGSLITALKIENVQASGVHLKTNKKPSERIHGI
LETPPRNFSSPRDKQTANSTLGSSKLAASVLIKVEAADNHNLKDIETVETNGESTVQANV
TIQTSSVVQERNLQETDEHAITKGSCTKAFGHASDKSTSKDLNESDIPGKLINASKRENP
SQLNNFACAVLKSASTKPLRDKAEFCGESKRKINMSEDLLEDELMQQGSNDSIIIKSSLG
VKQTSIGEGPKPAGAIVVTRLSAVKQEPKESGDEQAQNGTKAGQTREKHTSSQLVSQKQT
GAKKIPVIKGEGLLMLNPIKKDRNKQLEKFKGELQVKQSPKSQVLTIHKSNSIFSQKLES
QRLKFKWKVPTEMAKEPCLAEELGFKSPSGLKLKRQLKTGSTKENGGDESRDKTTKESLS
PLGGAKGTGDLPEISSTSLIHLKKRRITSSTGPILQENENLRDFQNRLVKSYDRSNQNLK
VIKVENDELLDSPTFTVPIPDKTDLKYMTMNQLRAVARHHNVHGVYKFRKAELQEHLHKL
LAKGRST
Download sequence
Identical sequences M1AYK1
PGSC0003DMP400022501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]