SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400023354 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400023354
Domain Number 1 Region: 60-267
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.89e-54
Family G proteins 0.00015
Further Details:      
 
Domain Number 2 Region: 244-342
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000136
Family Elongation factors 0.0071
Further Details:      
 
Domain Number 3 Region: 355-432
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000000000683
Family EF-G/eEF-2 domains III and V 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400023354
Sequence length 503
Comment PGSC0003DMT400034345
Sequence
MTTFKRASRALTSKLAAIYTCNFHPVTSLSHFSYTQNASFCSRPRQNNKGSTIDLNQYPS
DNIRNFSIIAHVDHGKSTLADRLLELTGTIRKGHGQPQYLDKLQVERERGITVKAQTATM
FHRHKFLGSDTDFLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQAQTVANFYL
AFESNLAIIPVINKIDQPTADPDRVKAQLKSMFDLNPSDVLLTSAKTGLGLEQVLPAAIE
RIPPPPGKSTSPLRMLLLDSYYDEYKGVICHVSIVDGALHKGDKICSAATGQSYEVSDVG
IMHPELVATGILLTGQVGYIVSGMRSTKEARVGDTLHHTRTVIQPLPGFKPAKHMVFSGL
YPADGSDFEALNHAIERLTCNDASVSVTKESSTALGLGFRCGFLGLLHMDVFHQRLEQEH
GAHVISTVPTVPYIFEYSDGSKLQVQNPAALPSNPKNRLIACWEPTVLATIIIPSMWGLL
SLYALSVAGSNWSTHSLIASELS
Download sequence
Identical sequences M1B0I5
PGSC0003DMP400023354 PGSC0003DMP400023355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]