SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400023356 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400023356
Domain Number 1 Region: 60-267
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.07e-53
Family G proteins 0.00015
Further Details:      
 
Domain Number 2 Region: 463-557
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 7.67e-24
Family EF-G/eEF-2 domains III and V 0.0091
Further Details:      
 
Domain Number 3 Region: 244-342
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000021
Family Elongation factors 0.0071
Further Details:      
 
Domain Number 4 Region: 355-432
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000000101
Family EF-G/eEF-2 domains III and V 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400023356
Sequence length 659
Comment PGSC0003DMT400034347
Sequence
MTTFKRASRALTSKLAAIYTCNFHPVTSLSHFSYTQNASFCSRPRQNNKGSTIDLNQYPS
DNIRNFSIIAHVDHGKSTLADRLLELTGTIRKGHGQPQYLDKLQVERERGITVKAQTATM
FHRHKFLGSDTDFLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQAQTVANFYL
AFESNLAIIPVINKIDQPTADPDRVKAQLKSMFDLNPSDVLLTSAKTGLGLEQVLPAAIE
RIPPPPGKSTSPLRMLLLDSYYDEYKGVICHVSIVDGALHKGDKICSAATGQSYEVSDVG
IMHPELVATGILLTGQVGYIVSGMRSTKEARVGDTLHHTRTVIQPLPGFKPAKHMVFSGL
YPADGSDFEALNHAIERLTCNDASVSVTKESSTALGLGFRCGFLGLLHMDVFHQRLEQEH
GAHVISTVPTVPYIFEYSDGSKLQVQNPAALPSNPKNRLIACWEPTVLATIIIPSEYVGS
VITLCAERRGEQLEYSFIDSQRAFMKYRMPLREIVVDFYNELKSITSGYASFDYEDSEYQ
ASDLVKLDILLNGQPVDAMATIVHKSKAPRVGRELVEKLKTFIDRQMFEIIIQAAIGSKV
IARETLSAMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS
Download sequence
Identical sequences M1B0I3
XP_006342295.1.80749 XP_006342296.1.80749 XP_015161988.1.80749 PGSC0003DMP400023353 PGSC0003DMP400023356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]