SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400023357 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400023357
Domain Number 1 Region: 13-148
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.34e-33
Family G proteins 0.0037
Further Details:      
 
Domain Number 2 Region: 344-438
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.76e-24
Family EF-G/eEF-2 domains III and V 0.0091
Further Details:      
 
Domain Number 3 Region: 125-223
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000154
Family Elongation factors 0.0071
Further Details:      
 
Domain Number 4 Region: 236-313
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000000000755
Family EF-G/eEF-2 domains III and V 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400023357
Sequence length 540
Comment PGSC0003DMT400034348
Sequence
MFHRHKFLGSDTDFLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQGVQAQTVANFY
LAFESNLAIIPVINKIDQPTADPDRVKAQLKSMFDLNPSDVLLTSAKTGLGLEQVLPAAI
ERIPPPPGKSTSPLRMLLLDSYYDEYKGVICHVSIVDGALHKGDKICSAATGQSYEVSDV
GIMHPELVATGILLTGQVGYIVSGMRSTKEARVGDTLHHTRTVIQPLPGFKPAKHMVFSG
LYPADGSDFEALNHAIERLTCNDASVSVTKESSTALGLGFRCGFLGLLHMDVFHQRLEQE
HGAHVISTVPTVPYIFEYSDGSKLQVQNPAALPSNPKNRLIACWEPTVLATIIIPSEYVG
SVITLCAERRGEQLEYSFIDSQRAFMKYRMPLREIVVDFYNELKSITSGYASFDYEDSEY
QASDLVKLDILLNGQPVDAMATIVHKSKAPRVGRELVEKLKTFIDRQMFEIIIQAAIGSK
VIARETLSAMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS
Download sequence
Identical sequences M1B0I7
PGSC0003DMP400023357 XP_006342297.1.80749 XP_006342298.1.80749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]