SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400025760 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400025760
Domain Number 1 Region: 62-282
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.22e-59
Family G proteins 0.000000146
Further Details:      
 
Domain Number 2 Region: 360-451
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.18e-34
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000169
Further Details:      
 
Domain Number 3 Region: 261-356
Classification Level Classification E-value
Superfamily Translation proteins 8.64e-31
Family Elongation factors 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400025760
Sequence length 451
Comment PGSC0003DMT400037909
Sequence
MASVAFRSSNSKRLLAVSPQLYSSCCRGSVPAQFSLSETINSNEAPAFCNHPWWRSMATF
TRTKPHVNVGTIGHVDHGKTTLTAAITKVLAEEGKAKAVAFDEIDKAPEEKKRGITIATA
HVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAPDGPMPQTKEHILLARQV
GVPSLVCFLNKVDAVDDPELLELVEMELRELLSFYKFPGDDIPIIRGSALSALQSTNEEI
GKKAILKLMEAVDDYIPDPVRQLDKPFLMPIEDVFSIQGRGTVATGRVEQGTIKVGEDVE
ILGLMQGTLKSTVTGVEMFKKILDHGQAGDNVGLLLRGLKRDDITRGMVIAKPGSVKTCK
KFEAEIYVLTKDEGGRHTAFFSNYMPQFYMRTADITGKVELPENVKMVMPGDNVTATFEL
MSPVPLDAGQRFALREGGRTVGAGVVSKVIN
Download sequence
Identical sequences M1B641
XP_006355793.1.80749 PGSC0003DMP400025760 PGSC0003DMP400025761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]