SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400027398 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400027398
Domain Number 1 Region: 50-276
Classification Level Classification E-value
Superfamily Translation proteins 4.68e-68
Family Ribosomal protein L3 0.00000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400027398
Sequence length 280
Comment PGSC0003DMT400040392
Sequence
MSLSSFSTMPTAKLRLKTLPTSTTITPLTLHSPFLPSFRLPKHKPLSILRISTSPAISAS
LEAGVGIMATKLGMMSFFEDSGTVVPVTVVGFREGNIITQIKTEATDGYSAVQVGYRRVR
DRKLTKPEMGHLEKSGIIPLRHLQEFRLQSVDGFEVTQKLDFNELFKEGDLVDVAGTTIG
KGFQGGIKRHNFKRGQMTHGSKSHRQLGSIGAGTTPGRVYKGKKMPGRMGGTKTKIRKLK
IVKIDDELKILMIKGALPGKPGNLLRIAPAKIVGKNIPKN
Download sequence
Identical sequences M1B9U2
PGSC0003DMP400027398 XP_006338816.1.80749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]