SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400029669 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400029669
Domain Number 1 Region: 3-154
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.81e-32
Family G proteins 0.082
Further Details:      
 
Domain Number 2 Region: 130-234
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000174
Family Restriction endonuclease FokI, N-terminal (recognition) domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400029669
Sequence length 262
Comment PGSC0003DMT400043724
Sequence
MARRLRFKKVLVVLDDINHGDHLENLAGDLDWFGKGSRIIATTRDKHLIGKNDVVYEVTT
LVDHQAIQLFNQHAFKDEVPDNSFEKLTLEVVCHANGLPLALKVWGSFLHNRDITAWRSA
IEQMKMNSKSEIVEKLKISYDGLETIQRDVFLHIACFLRGQTKEYIMQILESCYAGAAIE
LSVLIDKSLVFISDDDTIQMHDLIQDMGKYIVKLQKNDPSEYSRLWDPNDFEEVMVNNTG
TKRQQKQSGYKEFNIYALAKKP
Download sequence
Identical sequences M1BF49
PGSC0003DMP400029668 PGSC0003DMP400029669 PGSC0003DMP400029670 PGSC0003DMP400029671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]