SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400031489 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400031489
Domain Number 1 Region: 12-60
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000265
Family Ribosomal protein L35ae 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400031489
Sequence length 117
Comment PGSC0003DMT400046546
Sequence
MVKGRQGERVRLCTKGKVLGYKRSKSNQYPNTSLVQIEGVNTKEEVDWYLGKYMDYVYKA
KFLNVSEYYVAVFSLNDYFPTTSRSDTKITENTENTENTESTENTEIRTKIQTDFSK
Download sequence
Identical sequences M1BJ87
PGSC0003DMP400031489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]