SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400031700 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400031700
Domain Number 1 Region: 73-297
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.64e-60
Family G proteins 0.000000137
Further Details:      
 
Domain Number 2 Region: 376-476
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.64e-33
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000162
Further Details:      
 
Domain Number 3 Region: 283-379
Classification Level Classification E-value
Superfamily Translation proteins 2.55e-30
Family Elongation factors 0.0000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400031700
Sequence length 477
Comment PGSC0003DMT400046837
Sequence
MASISAASATATSSTKLLNPSNPLLPSATKPSKLILSSSFTPNLSTLFLHSPAATSPATH
HQRRFTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTMALASMGNSTPKKYDEIDA
APEERARGITINTATVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGP
MPQTKEHILLAKQVGVPNMVVFLNKQDQVDDEELLELVELEVRELLSSYEFPGDDIPIVS
GSALLALEALMANPSIKRGENEWVDKIFTLMDNVDNYIPIPQRQTELPFLMAIEDVFSIT
GRGTVATGRVERGTVRVGETVDIVGLRDTRSTTVTGVEMFQKILDEAMAGDNVGLLLRGI
QKIDIQRGMVLAKPGTITPHTKFEALVYVLKKEEGGRHSPFFSGYRPQFYMRTTDVTGKV
TSITTDKGDESKMVMPGDRVNLVVELIMPVACEQGMRFAIREGGKTVGAGVIQKILE
Download sequence
Identical sequences M1BJQ9
XP_006344478.1.80749 PGSC0003DMP400031700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]