SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400032004 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400032004
Domain Number 1 Region: 304-367
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000258
Family Gar1-like SnoRNP 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400032004
Sequence length 743
Comment PGSC0003DMT400047290
Sequence
MVDFLYNSTAEEVEDDKKSQPFSDPLSLLSIPDFDEFSLSFADSLLDFDSLSDLMSDSPM
ADRNQESLELDSVEVEFRSNDGVSEKCDIQTEDPLSCLNQEKCVSEKCDIQTEDPLSCLN
QEQSQIGVFKNGMKVEDFDCIVEEKMGRVSISGTEDERVVDQAGVGNVSGSVVAAAVISK
NEETDNKVVISSKAEERIVNDTGVNGNGSTVSNSDTESESESEASSSASSSDSDEDESSS
NDEAEEKVDMEEGEIVASDVDEMVGWDDDDEDTGVKGPIRSKNEVQVLPPVPEVTATLQP
HHQMQPVGVVTSTIGAQVVVEGVEKHSPLCDGSILWITENRSPLGIVDEIFGPVKNPYYI
VRYNSDNEVPPGIHPGTLISFVPEFSSHILNDNSLYKKGYDASGENDEEASEDEFSDDEK
EAEHRRMLKMKKRGITNDQKPGNKKKDKRNLKNRSQNWKHDQGVATDVQHENGKPSVDQS
PRFIPAAAAPVVQGIHQSATRQGHGQSIRPPSVPPFPHMQNSPGLASPSTGVWPNGFPYQ
QPQNMGFPNTLPNMGMSWPQQGHPQQMFQMPLPNALPFEQQINPTLPPSFIFPGGLPNFG
AGPSFGPWPAFGQNVFNQSPMAMGLPGQFTPAPMNLGGQVPANGPQSGQNNNSQPNAVVP
GYLNGSPNFNQGQSPSPMGLPGQFTPSPMNLGGQVPENGPKSGQNNINVSPNFNRGAHSG
GGRRGNHRGGGRFGGRRGRSQRN
Download sequence
Identical sequences M1BKH0
XP_006357517.1.80749 PGSC0003DMP400032004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]