SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400033243 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400033243
Domain Number 1 Region: 152-274
Classification Level Classification E-value
Superfamily NTF2-like 3.84e-30
Family SAV4671-like 0.008
Further Details:      
 
Weak hits

Sequence:  PGSC0003DMP400033243
Domain Number - Region: 121-151
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.017
Family C-terminal UvrC-binding domain of UvrB 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400033243
Sequence length 276
Comment PGSC0003DMT400049221
Sequence
MEVASNFQTLSFGPRISRTHSANIGRIEFRGYIASAHSNINGLQTDHRLPSAFQMQFNAV
STGRIKIGSGYFPGHGAFDSRSETFTPFRQGPHSHSLRPCRVMSEDSEGTLSGENILLNE
ESLAQDLKTAIKEENYARAAKIRDSLRLLQEDSKASVLAANARFYNSFRHGNLAAMQTLW
SKGENVCVVHPGVSGITGYDLVMGSWEFVWAEYDFPLDIEIRDVQVHVRGDIGYVTCIEM
VKTKGSSWGKQFATNVFEKVDGQWCMCIHHASYIDL
Download sequence
Identical sequences M1BNF6
PGSC0003DMP400033243 XP_006349481.1.80749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]