SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400034196 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400034196
Domain Number 1 Region: 3-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.45e-79
Family G proteins 0.0000000278
Further Details:      
 
Domain Number 2 Region: 326-430
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.44e-42
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000461
Further Details:      
 
Domain Number 3 Region: 231-321
Classification Level Classification E-value
Superfamily Translation proteins 9.5e-29
Family Elongation factors 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400034196
Sequence length 447
Comment PGSC0003DMT400050663
Sequence
MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK
VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQLNEPKRPSDKPLRLPLQD
VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV
KNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT
VAVGVIKSVDKKDPSGAKVTKAAQKKK
Download sequence
Identical sequences M1BQM9
XP_006340223.1.80749 XP_015170758.1.80749 PGSC0003DMP400034196 PGSC0003DMP400034197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]