SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400036103 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400036103
Domain Number 1 Region: 172-276
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 3.5e-43
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000512
Further Details:      
 
Domain Number 2 Region: 77-206
Classification Level Classification E-value
Superfamily Translation proteins 4.57e-33
Family Elongation factors 0.00000782
Further Details:      
 
Domain Number 3 Region: 6-95
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.15e-16
Family G proteins 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400036103
Sequence length 294
Comment PGSC0003DMT400053546
Sequence
MDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGP
TLLDALDQINEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLT
TEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVII
MNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIP
TKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTGAKVTKAAQKKGK
Download sequence
Identical sequences M1BV36
PGSC0003DMP400036103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]