SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400040752 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400040752
Domain Number 1 Region: 23-81,120-246
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.91e-40
Family G proteins 0.00000349
Further Details:      
 
Domain Number 2 Region: 240-354
Classification Level Classification E-value
Superfamily Translation proteins 2.5e-37
Family Elongation factors 0.0000432
Further Details:      
 
Domain Number 3 Region: 355-452
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.25e-29
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400040752
Sequence length 464
Comment PGSC0003DMT400060511
Sequence
MSRKGLMEQDLSKLDVTKLHPLSPEVIARQATINIGTIGHVAHGKSTVVKAISGVQTVRF
KNELERNITIKLGYANAKIYKCEEERCPRPACYKAYGSGKEDNPMCDVPGFENCKMKLLR
HVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPQTSEHLAAVEIMRLQHIIIL
QNKVDLVQENVAINQHEAIQKFIQGTVADGAPVVPISAQLKYNIDVVCEYIVKKIPIPER
NFTSPPNMIVIRSFDVNKPGFEVDDIRGGVAGGSILKGVLKVNQLIEIRPGIVVKDESGN
IKCTPIYSRIVSLFAEQNELQFAVPGGLIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVY
VELEVNFFLLRRLLGVRTKESERQGRVSKLAKGEILMLNIGSMSTGARVVAIKNVFAKLQ
LTSPVCTSKGEKIALSRRIEKHWRLIGWGEIQAGITLDVPSSPL
Download sequence
Identical sequences M1C613
XP_006345984.1.80749 XP_006345985.1.80749 XP_006345986.1.80749 XP_015163580.1.80749 PGSC0003DMP400040752 PGSC0003DMP400040753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]